Lineage for d3a7la_ (3a7l A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426783Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2426828Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2426829Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)
  8. 2426830Domain d3a7la_: 3a7l A: [171847]
    automated match to d1onla_

Details for d3a7la_

PDB Entry: 3a7l (more details), 1.3 Å

PDB Description: Crystal structure of E. coli apoH-protein
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7la_ b.84.1.1 (A:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yeallede

SCOPe Domain Coordinates for d3a7la_:

Click to download the PDB-style file with coordinates for d3a7la_.
(The format of our PDB-style files is described here.)

Timeline for d3a7la_: