Lineage for d2zx7b1 (2zx7 B:7-356)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570584Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins)
    glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
    automatically mapped to Pfam PF01120
  6. 1570593Protein automated matches [231482] (2 species)
    not a true protein
  7. 1570594Species Thermotoga maritima [TaxId:2336] [231744] (10 PDB entries)
  8. 1570604Domain d2zx7b1: 2zx7 B:7-356 [245026]
    Other proteins in same PDB: d2zx7a2, d2zx7b2
    automated match to d2zwyb1
    complexed with zx7

Details for d2zx7b1

PDB Entry: 2zx7 (more details), 2.48 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, f10-2c
PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zx7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zx7b1 c.1.8.11 (B:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

SCOPe Domain Coordinates for d2zx7b1:

Click to download the PDB-style file with coordinates for d2zx7b1.
(The format of our PDB-style files is described here.)

Timeline for d2zx7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zx7b2