Lineage for d2yxwb1 (2yxw B:31-170)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528843Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1528844Protein automated matches [190824] (20 species)
    not a true protein
  7. 1528953Species Escherichia coli [TaxId:562] [255718] (2 PDB entries)
  8. 1528956Domain d2yxwb1: 2yxw B:31-170 [244878]
    automated match to d1kv7a1
    complexed with c2o, cu, no3; mutant

Details for d2yxwb1

PDB Entry: 2yxw (more details), 1.5 Å

PDB Description: the deletion mutant of multicopper oxidase cueo
PDB Compounds: (B:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2yxwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxwb1 b.6.1.0 (B:31-170) automated matches {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

SCOPe Domain Coordinates for d2yxwb1:

Click to download the PDB-style file with coordinates for d2yxwb1.
(The format of our PDB-style files is described here.)

Timeline for d2yxwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yxwb2