Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (20 species) not a true protein |
Species Escherichia coli [TaxId:562] [255718] (2 PDB entries) |
Domain d2yxwa2: 2yxw A:171-335 [244877] automated match to d3od3a2 complexed with c2o, cu, no3; mutant |
PDB Entry: 2yxw (more details), 1.5 Å
SCOPe Domain Sequences for d2yxwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yxwa2 b.6.1.0 (A:171-335) automated matches {Escherichia coli [TaxId: 562]} mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls
Timeline for d2yxwa2: