Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (13 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [255714] (2 PDB entries) |
Domain d2yw2b3: 2yw2 B:323-423 [244841] Other proteins in same PDB: d2yw2a1, d2yw2a2, d2yw2b1, d2yw2b2 automated match to d1gsoa1 complexed with atp, po4 |
PDB Entry: 2yw2 (more details), 1.8 Å
SCOPe Domain Sequences for d2yw2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw2b3 b.84.2.0 (B:323-423) automated matches {Aquifex aeolicus [TaxId: 63363]} eryaldvvlasrgypekpetgkiihgldylksmedvvvfhagtkkegnftvtsggrvlnv caygktlkeakerayeairyvcfegmhyrkdigdkafkyls
Timeline for d2yw2b3: