Class b: All beta proteins [48724] (141 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (33 proteins) |
Protein SH3 domain from nebulin [50050] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50051] (2 PDB entries) |
Domain d1neb__: 1neb - [24472] |
PDB Entry: 1neb (more details)
SCOP Domain Sequences for d1neb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1neb__ b.34.2.1 (-) SH3 domain from nebulin {Human (Homo sapiens)} tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai
Timeline for d1neb__: