PDB entry 1neb

View 1neb on RCSB PDB site
Description: sh3 domain from human nebulin, nmr, minimized average structure
Deposited on 1997-08-07, released 1997-12-24
The last revision prior to the SCOP 1.67 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1neb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1neb_ (-)
    tagkiframydymaadadevsfkdgdaiinvqaidegwmygtvqrtgrtgmlpanyveai