Lineage for d2xnvd_ (2xnv D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811129Domain d2xnvd_: 2xnv D: [244548]
    automated match to d2c9ta_
    complexed with vu3

Details for d2xnvd_

PDB Entry: 2xnv (more details), 2.44 Å

PDB Description: acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2xnvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xnvd_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2xnvd_:

Click to download the PDB-style file with coordinates for d2xnvd_.
(The format of our PDB-style files is described here.)

Timeline for d2xnvd_: