Lineage for d2xd3a_ (2xd3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916169Species Streptococcus pneumoniae [TaxId:170187] [226722] (3 PDB entries)
  8. 2916171Domain d2xd3a_: 2xd3 A: [244487]
    automated match to d2fnca_
    complexed with so4

Details for d2xd3a_

PDB Entry: 2xd3 (more details), 2 Å

PDB Description: the crystal structure of malx from streptococcus pneumoniae in complex with maltopentaose.
PDB Compounds: (A:) maltose/maltodextrin-binding protein

SCOPe Domain Sequences for d2xd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xd3a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
eltvyvdegyksyieevakayekeagvkvtlktgdalggldklsldnqngnvpdvmmapy
drvgslgsdgqlsevklsdgaktddttkslvtaangkvygapavieslvmyynkdlvkda
pktfadlenlakdskyafagedgkttafladwtnfyytygllagngayvfgqngkdakdi
glandgsivginyakswyekwpkgmqdtegagnliqtqfqegktaaiidgpwkaqafkda
kvnygvatiptlpngkeyaafgggkawvipqavknleasqkfvdflvateqqkvlydktn
eipantearsyaegkndelttavikqfkntqplpnisqmsavwdpaknmlfdavsgqkda
ktaandavtliketl

SCOPe Domain Coordinates for d2xd3a_:

Click to download the PDB-style file with coordinates for d2xd3a_.
(The format of our PDB-style files is described here.)

Timeline for d2xd3a_: