SCOPe 2.05: Domain d2x5ul_: 2x5u L:

Lineage for d2x5ul_ (2x5u L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries)

8. Domain d2x5ul_: 2x5u L: [244431]
   Other proteins in same PDB: d2x5uc_, d2x5uh1, d2x5uh2
   automated match to d6prcl_
   complexed with bcb, bpb, fe2, hem, mq7

Details for d2x5ul_

PDB Entry: 2x5u, 3 Å

PDB Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre without illumination.

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2x5ul_:

Sequence; same for both SEQRES and ATOM records:

>d2x5ul_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d2x5ul_:

• d2x5ul_ first appeared in SCOPe 2.04
  
• d2x5ul_ appears in SCOPe 2.06
  
• d2x5ul_ appears in the current release, SCOPe 2.08