SCOP 1.57: Domain d1fqta_: 1fqt A:

Lineage for d1fqta_ (1fqt A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)

6. Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species)

7. Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry)

8. Domain d1fqta_: 1fqt A: [24441]

Details for d1fqta_

PDB Entry: 1fqt, 1.6 Å

PDB Description: crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase

SCOP Domain Sequences for d1fqta_:

Sequence; same for both SEQRES and ATOM records:

>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia}
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap

Timeline for d1fqta_:

• d1fqta_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqta_ appears in SCOP 1.59
  
• d1fqta_ appears in the current release, SCOPe 2.08