Lineage for d1fqta_ (1fqt A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13012Fold b.33: ISP domain [50021] (1 superfamily)
  4. 13013Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 13014Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. 13036Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species)
  7. 13037Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry)
  8. 13038Domain d1fqta_: 1fqt A: [24441]

Details for d1fqta_

PDB Entry: 1fqt (more details), 1.6 Å

PDB Description: crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase

SCOP Domain Sequences for d1fqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia}
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap

SCOP Domain Coordinates for d1fqta_:

Click to download the PDB-style file with coordinates for d1fqta_.
(The format of our PDB-style files is described here.)

Timeline for d1fqta_: