Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.7: NagZ-like [51553] (4 proteins) Pfam PF00933; Glycosyl hydrolase family 3 domain Some members have reversed beta strand compared to other members of fold |
Protein automated matches [191056] (3 species) not a true protein |
Species Thermotoga neapolitana [TaxId:309803] [255674] (2 PDB entries) |
Domain d2x41a1: 2x41 A:2-319 [244407] Other proteins in same PDB: d2x41a2, d2x41a3 automated match to d2x42a1 complexed with bgc, br |
PDB Entry: 2x41 (more details), 2.05 Å
SCOPe Domain Sequences for d2x41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x41a1 c.1.8.7 (A:2-319) automated matches {Thermotoga neapolitana [TaxId: 309803]} ekvneilsqltleekvklvvgvglpglfgnphsrvagaagethpvprvglpafvladgpa glrinptrendentyyttafpveimlastwnrelleevgkamgeevreygvdvllapamn ihrnplcgrnfeyysedpvlsgemassfvkgvqsqgvgacikhfvannqetnrmvvdtiv seralreiylrgfeiavkkskpwsvmsaynklngkycsqnewllkkvlreewgfegfvms dwyagdnpveqlkagndlimpgkayqvnterrdeieeimealkegklseevldecvrnil kvlvnapsfknyrysnkp
Timeline for d2x41a1: