Lineage for d2wzyd_ (2wzy D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811144Domain d2wzyd_: 2wzy D: [244367]
    automated match to d2c9ta_
    complexed with sqx

Details for d2wzyd_

PDB Entry: 2wzy (more details), 2.51 Å

PDB Description: crystal structure of a-achbp in complex with 13-desmethyl spirolide c
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wzyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wzyd_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeq
qrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmf
ipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeil
satqtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d2wzyd_:

Click to download the PDB-style file with coordinates for d2wzyd_.
(The format of our PDB-style files is described here.)

Timeline for d2wzyd_: