![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
![]() | Protein automated matches [254553] (3 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries) |
![]() | Domain d2wzha2: 2wzh A:127-436 [244359] Other proteins in same PDB: d2wzha1, d2wzha3 automated match to d2choa2 complexed with ca, gol, ngo |
PDB Entry: 2wzh (more details), 2.2 Å
SCOPe Domain Sequences for d2wzha2:
Sequence, based on SEQRES records: (download)
>d2wzha2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns dlgpnghgyr
>d2wzha2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnylttlgdklnpsiqimwt gdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfv tnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgp nghgyr
Timeline for d2wzha2: