Lineage for d2wqyo2 (2wqy O:115-246)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1718664Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1718665Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1718694Protein Succinate dehydogenase [81669] (3 species)
  7. 1718695Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)
  8. 1718699Domain d2wqyo2: 2wqy O:115-246 [244223]
    Other proteins in same PDB: d2wqyb1, d2wqyc_, d2wqyd_, d2wqyo1, d2wqyp_, d2wqyq_
    automated match to d1yq3b2
    complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl

Details for d2wqyo2

PDB Entry: 2wqy (more details), 2.1 Å

PDB Description: remodelling of carboxin binding to the q-site of avian respiratory complex ii
PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2wqyo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqyo2 a.1.2.1 (O:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

SCOPe Domain Coordinates for d2wqyo2:

Click to download the PDB-style file with coordinates for d2wqyo2.
(The format of our PDB-style files is described here.)

Timeline for d2wqyo2: