Lineage for d2wqyc_ (2wqy C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253424Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2253444Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2253524Protein automated matches [254461] (3 species)
    not a true protein
  7. 2253525Species Chicken (Gallus gallus) [TaxId:9031] [254987] (6 PDB entries)
  8. 2253534Domain d2wqyc_: 2wqy C: [244220]
    Other proteins in same PDB: d2wqyb1, d2wqyb2, d2wqyo1, d2wqyo2
    automated match to d1zoyc_
    complexed with azi, bhg, cbe, f3s, fad, fes, gol, hem, k, oaa, pee, sf4, unl

Details for d2wqyc_

PDB Entry: 2wqy (more details), 2.1 Å

PDB Description: remodelling of carboxin binding to the q-site of avian respiratory complex ii
PDB Compounds: (C:) Succinate dehydrogenase cytochrome B, large subunit

SCOPe Domain Sequences for d2wqyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqyc_ f.21.2.2 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
attakeemarfwekntkssrplsphisiykwslpmamsithrgtgvalslgvslfsvaal
llpeqfphyvavvkslslspaliysakfalvfplsyhtwngirhlvwdmgkgfklsqveq
sgvvvliltllssagiaais

SCOPe Domain Coordinates for d2wqyc_:

Click to download the PDB-style file with coordinates for d2wqyc_.
(The format of our PDB-style files is described here.)

Timeline for d2wqyc_: