SCOPe 2.05: Domain d2wnlc_: 2wnl C:

Lineage for d2wnlc_ (2wnl C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d2wnlc_: 2wnl C: [244193]
   automated match to d2c9ta_
   complexed with an4, an5, mg, nag, pg4

Details for d2wnlc_

PDB Entry: 2wnl, 2.7 Å

PDB Description: crystal structure of aplysia achbp in complex with anabaseine

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wnlc_:

Sequence, based on SEQRES records:

>d2wnlc_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeq
qrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmf
ipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeil
satqtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d2wnlc_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dklhsqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqr
wklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfip
aqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsa
tqtrqvqhysccpepyidvnlvvkfrerr

Timeline for d2wnlc_:

• d2wnlc_ first appeared in SCOPe 2.04
  
• d2wnlc_ is called d2wnlc1 in SCOPe 2.06
  
• d2wnlc_ appears in the current release, SCOPe 2.08, called d2wnlc1