Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries) |
Domain d2vzoa4: 2vzo A:675-777 [243969] Other proteins in same PDB: d2vzoa1, d2vzoa3, d2vzob1, d2vzob3 automated match to d2vzsa3 complexed with act, cd, gol |
PDB Entry: 2vzo (more details), 2.24 Å
SCOPe Domain Sequences for d2vzoa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzoa4 b.1.4.0 (A:675-777) automated matches {Amycolatopsis orientalis [TaxId: 31958]} plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg
Timeline for d2vzoa4: