Lineage for d2vzoa3 (2vzo A:336-674)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441025Species Amycolatopsis orientalis [TaxId:31958] [255631] (4 PDB entries)
  8. 2441030Domain d2vzoa3: 2vzo A:336-674 [243968]
    Other proteins in same PDB: d2vzoa1, d2vzoa2, d2vzoa4, d2vzoa5, d2vzob1, d2vzob2, d2vzob4, d2vzob5
    automated match to d2vzsa5
    complexed with act, cd, gol

Details for d2vzoa3

PDB Entry: 2vzo (more details), 2.24 Å

PDB Description: crystal structure of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzoa3 c.1.8.0 (A:336-674) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg
hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl
rdhpsvisfhigsefapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp
ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy
hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp
stgliywmlnspwtslhwqlfdaymdqngayygakkane

SCOPe Domain Coordinates for d2vzoa3:

Click to download the PDB-style file with coordinates for d2vzoa3.
(The format of our PDB-style files is described here.)

Timeline for d2vzoa3: