Lineage for d2uunu_ (2uun U:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718329Species Leptolyngbya sp. [TaxId:47254] [255594] (1 PDB entry)
  8. 1718350Domain d2uunu_: 2uun U: [243819]
    automated match to d1gh0a_
    complexed with bla, cyc

Details for d2uunu_

PDB Entry: 2uun (more details), 3 Å

PDB Description: crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers.
PDB Compounds: (U:) c-phycocyanin

SCOPe Domain Sequences for d2uunu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uunu_ a.1.1.3 (U:) automated matches {Leptolyngbya sp. [TaxId: 47254]}
mktpltdavstadsqgrflssteiqvafgrfrqaaaglsaataltsaadalisgaaqavy
nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr
tfelspswyiealkyikanhglagdaaaeansyldyainals

SCOPe Domain Coordinates for d2uunu_:

Click to download the PDB-style file with coordinates for d2uunu_.
(The format of our PDB-style files is described here.)

Timeline for d2uunu_: