SCOPe 2.05: Domain d2rrta_: 2rrt A:

Lineage for d2rrta_ (2rrt A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (20 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225045] (3 PDB entries)

8. Domain d2rrta_: 2rrt A: [243761]
   automated match to d1cmga_
   mutant

Details for d2rrta_

PDB Entry: 2rrt

PDB Description: Solution structure of Magnesium-bound form of calmodulin C-domain E104D/E140D mutant

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2rrta_:

Sequence; same for both SEQRES and ATOM records:

>d2rrta_ a.39.1.5 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mdtdseeeireafrvfdkdgngyisaadlrhvmtnlgekltdeevdemireadidgdgqv
nyedfvqmmtak

Timeline for d2rrta_:

• d2rrta_ first appeared in SCOPe 2.04
  
• d2rrta_ is called d2rrta1 in SCOPe 2.06
  
• d2rrta_ appears in the current release, SCOPe 2.08, called d2rrta1