Lineage for d2rjma1 (2rjm A:-2-92)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767462Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (15 PDB entries)
  8. 1767472Domain d2rjma1: 2rjm A:-2-92 [243714]
    automated match to d1fhga_

Details for d2rjma1

PDB Entry: 2rjm (more details), 2 Å

PDB Description: 3Ig structure of titin domains I67-I69 E-to-A mutated variant
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2rjma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjma1 b.1.1.0 (A:-2-92) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
amappffdlkpvsvdlalgesgtfkchvtgtapikitwakdnreirpggnykmtlventa
tltvlkvtkgdagqytcyasnvagkdscsaqlgvq

SCOPe Domain Coordinates for d2rjma1:

Click to download the PDB-style file with coordinates for d2rjma1.
(The format of our PDB-style files is described here.)

Timeline for d2rjma1: