SCOPe 2.05: Domain d2rika2: 2rik A:93-186

Lineage for d2rika2 (2rik A:93-186)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (15 PDB entries)

8. Domain d2rika2: 2rik A:93-186 [243700]
   automated match to d1fhga_

Details for d2rika2

PDB Entry: 2rik, 1.6 Å

PDB Description: I-band fragment I67-I69 from titin

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2rika2:

Sequence; same for both SEQRES and ATOM records:

>d2rika2 b.1.1.0 (A:93-186) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
epprfikklepsrivkqdehtryeckiggspeikvlwykdeteiqesskfrmsfvesvav
lemynlsvedsgdytceahnaagsassstslkvk

Timeline for d2rika2:

• d2rika2 first appeared in SCOPe 2.04
  
• d2rika2 appears in SCOPe 2.06
  
• d2rika2 appears in the current release, SCOPe 2.08