Lineage for d2qq2k_ (2qq2 K:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646749Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1646750Protein automated matches [190143] (26 species)
    not a true protein
  7. 1646808Species Human (Homo sapiens) [TaxId:9606] [255571] (1 PDB entry)
  8. 1646819Domain d2qq2k_: 2qq2 K: [243619]
    automated match to d1vpmb_

Details for d2qq2k_

PDB Entry: 2qq2 (more details), 2.8 Å

PDB Description: Crystal structure of C-terminal domain of Human acyl-CoA thioesterase 7
PDB Compounds: (K:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d2qq2k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq2k_ d.38.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pepntvsysqsslihlvgpsdctlhgfvhggvtmklmdevagivaarhcktnivtasvda
infhdkirkgcvitisgrmtftsnksmeievlvdadpvvdssqkryraasafftyvslsq
egrslpvpqlvpetedekkrfeegkgrylqmkakrq

SCOPe Domain Coordinates for d2qq2k_:

Click to download the PDB-style file with coordinates for d2qq2k_.
(The format of our PDB-style files is described here.)

Timeline for d2qq2k_: