SCOPe 2.06: Domain d2q01b_: 2q01 B:

Lineage for d2q01b_ (2q01 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:190650] [255551] (1 PDB entry)

8. Domain d2q01b_: 2q01 B: [243511]
   automated match to d3iaca_
   complexed with k

Details for d2q01b_

PDB Entry: 2q01, 2.34 Å

PDB Description: crystal structure of glucuronate isomerase from caulobacter crescentus

PDB Compounds: (B:) uronate isomerase

SCOPe Domain Sequences for d2q01b_:

Sequence; same for both SEQRES and ATOM records:

>d2q01b_ c.1.9.0 (B:) automated matches {Caulobacter vibrioides [TaxId: 190650]}
rplsfhedrlfpsdpatrsyarglyalvkdlpiisphghtdpswfatnapfqdatdllla
pdhylfrmlysqgvsldalkvrskagvpdtdpreawrvfashfylfrgtpswvwlnhvfs
qvfgftefleasnaddyfdritaalatdafrpralfdrfnietlattegpheslqhhaai
resgwgghvitayrpdavidfederspraferfaetsgqdvyswksyleahrlrrqafid
agatssdhghptaatadlsdveaealfnslvkgdvtpekaelfraqmltemakmslddgl
vmqihpgshrnhnvgllnshgrdkgadipmrteyvdalkplltrlgndprlsiilftlde
ttysrelaplaghypvlklgpswwfhdspegmmrfreqvtetagfyntvgfnddtrafls
iparhdvarrvdsaflarmvaehrmdlveaeelivdltynlpkkaykldqrpdwarpatl

Timeline for d2q01b_:

• d2q01b_ first appeared in SCOPe 2.04
  
• d2q01b_ appears in SCOPe 2.05
  
• d2q01b_ appears in SCOPe 2.07
  
• d2q01b_ appears in the current release, SCOPe 2.08