Lineage for d2pc5c_ (2pc5 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560843Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1560844Protein automated matches [191182] (11 species)
    not a true protein
  7. 1561026Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255543] (2 PDB entries)
  8. 1561032Domain d2pc5c_: 2pc5 C: [243471]
    automated match to d3so2a_
    complexed with mg

Details for d2pc5c_

PDB Entry: 2pc5 (more details), 2.2 Å

PDB Description: Native crystal structure analysis on Arabidopsis dUTPase
PDB Compounds: (C:) DUTP pyrophosphatase-like protein

SCOPe Domain Sequences for d2pc5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pc5c_ b.85.4.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari
aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv
vevddld

SCOPe Domain Coordinates for d2pc5c_:

Click to download the PDB-style file with coordinates for d2pc5c_.
(The format of our PDB-style files is described here.)

Timeline for d2pc5c_: