Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255543] (3 PDB entries) |
Domain d2pc5c_: 2pc5 C: [243471] automated match to d3so2a_ complexed with mg |
PDB Entry: 2pc5 (more details), 2.2 Å
SCOPe Domain Sequences for d2pc5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pc5c_ b.85.4.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv vevddld
Timeline for d2pc5c_: