Lineage for d2ousa1 (2ous A:449-771)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2019338Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2019339Protein automated matches [190983] (9 species)
    not a true protein
  7. 2019353Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2019354Domain d2ousa1: 2ous A:449-771 [243386]
    Other proteins in same PDB: d2ousa2, d2ousb2
    automated match to d2ourb_
    complexed with mg; mutant

Details for d2ousa1

PDB Entry: 2ous (more details), 1.45 Å

PDB Description: crystal structure of pde10a2 mutant d674a
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2ousa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ousa1 a.211.1.0 (A:449-771) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacalcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeet

SCOPe Domain Coordinates for d2ousa1:

Click to download the PDB-style file with coordinates for d2ousa1.
(The format of our PDB-style files is described here.)

Timeline for d2ousa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ousa2