![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries) |
![]() | Domain d2ousa1: 2ous A:449-771 [243386] Other proteins in same PDB: d2ousa2, d2ousb2 automated match to d2ourb_ complexed with mg; mutant |
PDB Entry: 2ous (more details), 1.45 Å
SCOPe Domain Sequences for d2ousa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ousa1 a.211.1.0 (A:449-771) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacalcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvirgeet
Timeline for d2ousa1: