Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries) |
Domain d2ntyc_: 2nty C: [243237] automated match to d2j0va_ complexed with gdp |
PDB Entry: 2nty (more details), 3.1 Å
SCOPe Domain Sequences for d2ntyc_:
Sequence, based on SEQRES records: (download)
>d2ntyc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} srfikcvtvgdgavgktcmlisytsntfptdyvptvfdnfsanvvvdgntvnlglwdtag qedynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlr ddkqffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq
>d2ntyc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} srfikcvtvgdgavgktcmlisytsntfptptvfdnfsanvvvdgntvnlglwdtagqed ynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlrddk qffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq
Timeline for d2ntyc_: