SCOPe 2.05: Domain d2ntyc_: 2nty C:

Lineage for d2ntyc_ (2nty C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries)

8. Domain d2ntyc_: 2nty C: [243237]
   automated match to d2j0va_
   complexed with gdp

Details for d2ntyc_

PDB Entry: 2nty, 3.1 Å

PDB Description: rop4-gdp-prone8

PDB Compounds: (C:) Rac-like GTP-binding protein ARAC5

SCOPe Domain Sequences for d2ntyc_:

Sequence, based on SEQRES records:

>d2ntyc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srfikcvtvgdgavgktcmlisytsntfptdyvptvfdnfsanvvvdgntvnlglwdtag
qedynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlr
ddkqffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq

Sequence, based on observed residues (ATOM records):

>d2ntyc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srfikcvtvgdgavgktcmlisytsntfptptvfdnfsanvvvdgntvnlglwdtagqed
ynrlrplsyrgadvfilafsliskasyenvakkwipelrhyapgvpiilvgtkldlrddk
qffidhpgavpittnqgeelkkligspiyiecssktqqnvkavfdaaikvvlq

Timeline for d2ntyc_:

• d2ntyc_ first appeared in SCOPe 2.04
  
• d2ntyc_ appears in SCOPe 2.06
  
• d2ntyc_ appears in the current release, SCOPe 2.08