SCOPe 2.06: Domain d2m4za_: 2m4z A:

Lineage for d2m4za_ (2m4z A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.6: omega toxin-like [57059] (5 families)

5. Family g.3.6.2: Spider toxins [57072] (26 proteins)

6. Protein automated matches [254476] (8 species)
   not a true protein

7. Species Haplopelma schmidti [TaxId:29017] [255481] (3 PDB entries)

8. Domain d2m4za_: 2m4z A: [243109]
   automated match to d1mb6a_

Details for d2m4za_

PDB Entry: 2m4z

PDB Description: Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, Huwentoxin-IV (-TRTX-Hh2a).

PDB Compounds: (A:) Mu-theraphotoxin-Hh2a

SCOPe Domain Sequences for d2m4za_:

Sequence; same for both SEQRES and ATOM records:

>d2m4za_ g.3.6.2 (A:) automated matches {Haplopelma schmidti [TaxId: 29017]}
ecleifkacnpsndqcckssklvcsrktrackyqi

Timeline for d2m4za_:

• d2m4za_ first appeared in SCOPe 2.04
  
• d2m4za_ appears in SCOPe 2.05
  
• d2m4za_ appears in SCOPe 2.07
  
• d2m4za_ appears in the current release, SCOPe 2.08