SCOPe 2.05: Domain d2m3wa_: 2m3w A:

Lineage for d2m3wa_ (2m3w A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (35 PDB entries)

8. Domain d2m3wa_: 2m3w A: [243098]
   automated match to d1k2ha_

Details for d2m3wa_

PDB Entry: 2m3w

PDB Description: Protein structure determination from a set of 4D NOESY

PDB Compounds: (A:) Protein S100-A1

SCOPe Domain Sequences for d2m3wa_:

Sequence; same for both SEQRES and ATOM records:

>d2m3wa_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gseletametlinvfhahsgkegdkyklskkqlkellqtelsgfldaqkdvdavdkvmke
ldengdgevdfqeyvvlvaaltvacnnffwens

Timeline for d2m3wa_:

• d2m3wa_ first appeared in SCOPe 2.04
  
• d2m3wa_ appears in SCOPe 2.06
  
• d2m3wa_ appears in the current release, SCOPe 2.08