Class a: All alpha proteins [46456] (286 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein automated matches [190369] (6 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries) |
Domain d2lf4a1: 2lf4 A:0-147 [242866] Other proteins in same PDB: d2lf4a2 automated match to d3ntea1 mutant |
PDB Entry: 2lf4 (more details)
SCOPe Domain Sequences for d2lf4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lf4a1 a.73.1.1 (A:0-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} mpivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntv gghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmt hnppipvgeiykrwiilglnkivrmysp
Timeline for d2lf4a1: