SCOPe 2.05: Domain d2lf4a1: 2lf4 A:0-147

Lineage for d2lf4a1 (2lf4 A:0-147)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (6 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)

8. Domain d2lf4a1: 2lf4 A:0-147 [242866]
   Other proteins in same PDB: d2lf4a2
   automated match to d3ntea1
   mutant

Details for d2lf4a1

PDB Entry: 2lf4

PDB Description: Structure of a monomeric mutant of the HIV-1 capsid protein

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2lf4a1:

Sequence; same for both SEQRES and ATOM records:

>d2lf4a1 a.73.1.1 (A:0-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
mpivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntv
gghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmt
hnppipvgeiykrwiilglnkivrmysp

Timeline for d2lf4a1:

• d2lf4a1 first appeared in SCOPe 2.04
  
• d2lf4a1 appears in SCOPe 2.06
  
• d2lf4a1 appears in the current release, SCOPe 2.08