SCOPe 2.06: Domain d1cela_: 1cel A:

Lineage for d1cela_ (1cel A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (7 species)

7. Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (21 PDB entries)

8. Domain d1cela_: 1cel A: [24280]
   complexed with bgc, ca, glc, ibz, nag

Details for d1cela_

PDB Entry: 1cel, 1.8 Å

PDB Description: the three-dimensional crystal structure of the catalytic core of cellobiohydrolase i from trichoderma reesei

PDB Compounds: (A:) 1,4-beta-d-glucan cellobiohydrolase I

SCOPe Domain Sequences for d1cela_:

Sequence; same for both SEQRES and ATOM records:

>d1cela_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

Timeline for d1cela_:

• d1cela_ first appeared (with stable ids) in SCOP 1.55
  
• d1cela_ appears in SCOPe 2.05
  
• d1cela_ appears in SCOPe 2.07
  
• d1cela_ appears in the current release, SCOPe 2.08