Lineage for d2l74a_ (2l74 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2404039Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. 2404040Family b.45.2.1: PilZ domain [141372] (3 proteins)
    Pfam PF07238
  6. 2404041Protein Hypothetical protein PA4608 [141375] (1 species)
  7. 2404042Species Pseudomonas aeruginosa [TaxId:287] [141376] (4 PDB entries)
    Uniprot Q9HVI1 1-125
  8. 2404047Domain d2l74a_: 2l74 A: [242794]
    automated match to d1ywua1
    complexed with c2e

Details for d2l74a_

PDB Entry: 2l74 (more details)

PDB Description: Solution structure of the PilZ domain protein PA4608 complex with c-di-GMP identifies charge clustering as molecular readout
PDB Compounds: (A:) Putative uncharacterized protein PA4608

SCOPe Domain Sequences for d2l74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l74a_ b.45.2.1 (A:) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear
lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv
sahdd

SCOPe Domain Coordinates for d2l74a_:

Click to download the PDB-style file with coordinates for d2l74a_.
(The format of our PDB-style files is described here.)

Timeline for d2l74a_: