![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.2: PilZ domain-like [141371] (2 families) ![]() |
![]() | Family b.45.2.1: PilZ domain [141372] (3 proteins) Pfam PF07238 |
![]() | Protein Hypothetical protein PA4608 [141375] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141376] (4 PDB entries) Uniprot Q9HVI1 1-125 |
![]() | Domain d2l74a_: 2l74 A: [242794] automated match to d1ywua1 complexed with c2e |
PDB Entry: 2l74 (more details)
SCOPe Domain Sequences for d2l74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l74a_ b.45.2.1 (A:) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]} msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv sahdd
Timeline for d2l74a_: