Lineage for d1ywua1 (1ywu A:1-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2404039Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. 2404040Family b.45.2.1: PilZ domain [141372] (3 proteins)
    Pfam PF07238
  6. 2404041Protein Hypothetical protein PA4608 [141375] (1 species)
  7. 2404042Species Pseudomonas aeruginosa [TaxId:287] [141376] (4 PDB entries)
    Uniprot Q9HVI1 1-125
  8. 2404046Domain d1ywua1: 1ywu A:1-125 [124164]

Details for d1ywua1

PDB Entry: 1ywu (more details)

PDB Description: Solution NMR structure of Pseudomonas Aeruginosa protein PA4608. Northeast Structural Genomics target PaT7
PDB Compounds: (A:) hypothetical protein PA4608

SCOPe Domain Sequences for d1ywua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear
lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv
sahdd

SCOPe Domain Coordinates for d1ywua1:

Click to download the PDB-style file with coordinates for d1ywua1.
(The format of our PDB-style files is described here.)

Timeline for d1ywua1: