Lineage for d2kz1b2 (2kz1 B:110-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371989Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)
  7. 2371990Species Human (Homo sapiens) [TaxId:9606] [89200] (5 PDB entries)
  8. 2371994Domain d2kz1b2: 2kz1 B:110-206 [242708]
    Other proteins in same PDB: d2kz1a_
    automated match to d2hyma2

Details for d2kz1b2

PDB Entry: 2kz1 (more details)

PDB Description: inter-molecular interactions in a 44 kda interferon-receptor complex detected by asymmetric back-protonation and 2d noesy
PDB Compounds: (B:) Soluble IFN alpha/beta receptor

SCOPe Domain Sequences for d2kz1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kz1b2 b.1.2.1 (B:110-206) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppg

SCOPe Domain Coordinates for d2kz1b2:

Click to download the PDB-style file with coordinates for d2kz1b2.
(The format of our PDB-style files is described here.)

Timeline for d2kz1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kz1b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2kz1a_