Lineage for d2kyqa_ (2kyq A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1700854Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1701144Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 1701197Protein automated matches [191215] (5 species)
    not a true protein
  7. 1701200Species J'oublie (Pentadiplandra brazzeana) [TaxId:43545] [255389] (1 PDB entry)
  8. 1701201Domain d2kyqa_: 2kyq A: [242702]
    automated match to d4he7a_

Details for d2kyqa_

PDB Entry: 2kyq (more details)

PDB Description: 1H, 15N, 13C chemical shifts and structure of CKR-brazzein
PDB Compounds: (A:) Defensin-like protein

SCOPe Domain Sequences for d2kyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kyqa_ g.3.7.5 (A:) automated matches {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]}
dckrkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey

SCOPe Domain Coordinates for d2kyqa_:

Click to download the PDB-style file with coordinates for d2kyqa_.
(The format of our PDB-style files is described here.)

Timeline for d2kyqa_: