Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) |
Family g.3.7.5: Plant defensins [57170] (9 proteins) |
Protein automated matches [191215] (5 species) not a true protein |
Species J'oublie (Pentadiplandra brazzeana) [TaxId:43545] [255389] (1 PDB entry) |
Domain d2kyqa_: 2kyq A: [242702] automated match to d4he7a_ |
PDB Entry: 2kyq (more details)
SCOPe Domain Sequences for d2kyqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kyqa_ g.3.7.5 (A:) automated matches {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]} dckrkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey
Timeline for d2kyqa_: