SCOPe 2.06: Domain d2knia1: 2kni A:2-41

Lineage for d2knia1 (2kni A:2-41)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.6: omega toxin-like [57059] (5 families)

5. Family g.3.6.2: Spider toxins [57072] (26 proteins)

6. Protein automated matches [254476] (8 species)
   not a true protein

7. Species Spider (Psalmopoeus cambridgei) [TaxId:179874] [255364] (1 PDB entry)

8. Domain d2knia1: 2kni A:2-41 [242583]
   Other proteins in same PDB: d2knia2
   automated match to d1lmma_

Details for d2knia1

PDB Entry: 2kni

PDB Description: high-resolution solution structure of the asic1a blocker pctx1

PDB Compounds: (A:) Psalmotoxin-1

SCOPe Domain Sequences for d2knia1:

Sequence; same for both SEQRES and ATOM records:

>d2knia1 g.3.6.2 (A:2-41) automated matches {Spider (Psalmopoeus cambridgei) [TaxId: 179874]}
edcipkwkgcvnrhgdcceglecwkrrrsfevcvpktpkt

Timeline for d2knia1:

• d2knia1 first appeared in SCOPe 2.04, called d2knia_
  
• d2knia1 was called d2knia_ in SCOPe 2.05
  
• d2knia1 appears in SCOPe 2.07
  
• d2knia1 appears in the current release, SCOPe 2.08