Lineage for d2knbb_ (2knb B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1784061Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (4 PDB entries)
  8. 1784065Domain d2knbb_: 2knb B: [242579]
    Other proteins in same PDB: d2knba_
    automated match to d3iqlb_

Details for d2knbb_

PDB Entry: 2knb (more details)

PDB Description: Solution NMR structure of the parkin Ubl domain in complex with the endophilin-A1 SH3 domain
PDB Compounds: (B:) Endophilin-A1

SCOPe Domain Sequences for d2knbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knbb_ b.34.2.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyveilval
ph

SCOPe Domain Coordinates for d2knbb_:

Click to download the PDB-style file with coordinates for d2knbb_.
(The format of our PDB-style files is described here.)

Timeline for d2knbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2knba_