SCOPe 2.04: Domain d2klia_: 2kli A:

Lineage for d2klia_ (2kli A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Sensor protein CYB2465 [160659] (2 species)

7. Species Synechococcus sp. [TaxId:321332] [255356] (1 PDB entry)

8. Domain d2klia_: 2kli A: [242553]
   automated match to d2k2na1
   complexed with cyc

Details for d2klia_

PDB Entry: 2kli

PDB Description: structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form

PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d2klia_:

Sequence; same for both SEQRES and ATOM records:

>d2klia_ d.110.2.1 (A:) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 321332]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqaelsl

Timeline for d2klia_:

• d2klia_ is new in SCOPe 2.04-stable
  
• d2klia_ appears in SCOPe 2.05
  
• d2klia_ appears in the current release, SCOPe 2.08, called d2klia1