PDB entry 2kli

View 2kli on RCSB PDB site
Description: Structural Basis for the Photoconversion of A Phytochrome to the Activated FAR-RED LIGHT-ABSORBING Form
Class: transferase
Keywords: Phytochrome, Kinase, Phosphoprotein, Transferase, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2009-07-03, released 2009-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sensor protein
  Species: Synechococcus sp. JA-2-3B'a(2-13) [TaxId:321332]
  Gene: CYB_2465
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2JIZ5 (0-169)
    • expression tag (170-171)
  Domains in SCOPe 2.04: d2klia_
• Heterogens: CYC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kliA (A:)
  ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
  arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
  slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqaelsl