Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Itk/tsk protein tyrosine kinase [82743] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries) |
Domain d2k79b_: 2k79 B: [242392] Other proteins in same PDB: d2k79a_ automated match to d1oo4a_ |
PDB Entry: 2k79 (more details)
SCOPe Domain Sequences for d2k79b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k79b_ d.93.1.1 (B:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg
Timeline for d2k79b_: