SCOPe 2.04: Domain d2jzya_: 2jzy A:

Lineage for d2jzya_ (2jzy A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries)

8. Domain d2jzya_: 2jzy A: [242326]
   automated match to d1gxpa_

Details for d2jzya_

PDB Entry: 2jzy

PDB Description: solution structure of c-terminal effector domain of putative two- component-system response regulator involved in copper resistance from klebsiella pneumoniae

PDB Compounds: (A:) Transcriptional regulatory protein PcoR

SCOPe Domain Sequences for d2jzya_:

Sequence; same for both SEQRES and ATOM records:

>d2jzya_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maatvctiadmtvdmvrrtvirsgkkihltgkeyvllelllqrtgevlprslisslvwnm
nfdsdtnvidvavrrlrskidddfepklihtvrgagyvleiree

Timeline for d2jzya_:

• d2jzya_ is new in SCOPe 2.04-stable
  
• d2jzya_ appears in SCOPe 2.05
  
• d2jzya_ appears in the current release, SCOPe 2.08