Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.1: PhoB-like [46895] (5 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
Protein PhoB [46898] (2 species) |
Species Escherichia coli [TaxId:562] [46899] (4 PDB entries) |
Domain d1gxpa_: 1gxp A: [70717] protein/DNA complex |
PDB Entry: 1gxp (more details), 2.5 Å
SCOPe Domain Sequences for d1gxpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxpa_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]} aveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgt nvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
Timeline for d1gxpa_: