Class a: All alpha proteins [46456] (289 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (45 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (37 PDB entries) |
Domain d2i19a_: 2i19 A: [242082] automated match to d2ewga_ complexed with 1by, mg |
PDB Entry: 2i19 (more details), 2.28 Å
SCOPe Domain Sequences for d2i19a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i19a_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg ktykrqk
Timeline for d2i19a_: