Lineage for d2i19a_ (2i19 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504597Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1504598Protein automated matches [196409] (27 species)
    not a true protein
  7. 1504727Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (9 PDB entries)
  8. 1504740Domain d2i19a_: 2i19 A: [242082]
    automated match to d2ewga_
    complexed with 1by, mg

Details for d2i19a_

PDB Entry: 2i19 (more details), 2.28 Å

PDB Description: T. Brucei farnesyl diphosphate synthase complexed with bisphosphonate
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2i19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i19a_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
ktykrqk

SCOPe Domain Coordinates for d2i19a_:

Click to download the PDB-style file with coordinates for d2i19a_.
(The format of our PDB-style files is described here.)

Timeline for d2i19a_: