Lineage for d2hv1b_ (2hv1 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665549Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1665775Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 1665776Protein automated matches [190492] (15 species)
    not a true protein
  7. 1665803Species Human (Homo sapiens) [TaxId:9606] [187434] (16 PDB entries)
  8. 1665818Domain d2hv1b_: 2hv1 B: [242078]
    automated match to d3h82b_

Details for d2hv1b_

PDB Entry: 2hv1 (more details)

PDB Description: haddock structure of arnt pas-b homodimer
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d2hv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv1b_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvk

SCOPe Domain Coordinates for d2hv1b_:

Click to download the PDB-style file with coordinates for d2hv1b_.
(The format of our PDB-style files is described here.)

Timeline for d2hv1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hv1a_