SCOPe 2.08: Domain d2hv1b_: 2hv1 B:

Lineage for d2hv1b_ (2hv1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)

8. Domain d2hv1b_: 2hv1 B: [242078]
   automated match to d3h82b_

Details for d2hv1b_

PDB Entry: 2hv1

PDB Description: haddock structure of arnt pas-b homodimer

PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d2hv1b_:

Sequence; same for both SEQRES and ATOM records:

>d2hv1b_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvk

Timeline for d2hv1b_:

• d2hv1b_ first appeared in SCOPe 2.04
  
• d2hv1b_ appears in SCOPe 2.07